Protein Info for Atu0063 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 28 to 256 (229 residues), 71.5 bits, see alignment E=8.4e-24 PF13407: Peripla_BP_4" amino acids 31 to 300 (270 residues), 154.2 bits, see alignment E=4.8e-49

Best Hits

Swiss-Prot: 86% identical to FRCB_RHIML: Fructose import binding protein FrcB (frcB) from Rhizobium meliloti

KEGG orthology group: K10552, fructose transport system substrate-binding protein (inferred from 99% identity to agr:AGROH133_02883)

Predicted SEED Role

"Fructose ABC transporter, substrate-binding component FrcB" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKR7 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Atu0063 ABC transporter, substrate binding protein (sugar) (Agrobacterium fabrum C58)
MKTTVSALLGALALGVSFASAASAADTSVCLITKTDTNPFFVKMKEGATAKAKELGVTLK
SYAGKIDGDSESQVAAIETCIADGAKGILITASDTKGIVPAVQKARDAGLLVIALDTPLE
PVDAADSTFATDNLLAGELIGKWAAGTLGDKAKDAKIAFLNLTPSQPTVDVLRNQGFMKG
FGIDVKDINKIGDEDDKRIVGHDVTNGNEEGGRSAMENLLQKDPTINVVHTINEPAAAGA
YEALKAVGREKDVLIVSVDGGCPGVKNVAEGVIGATSQQYPLLMAALGVEAVKKFADTGE
KPKPTAGKNFFDTGVTLVTDKPVKGLDSIDTKEGLKKCWG