Protein Info for Atu0039 in Agrobacterium fabrum C58

Annotation: imidazoleglycerol-phosphate synthase cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 3 to 256 (254 residues), 344.6 bits, E=1.5e-107
• PF00977: His_biosynth
  • amino acids 6 to 239 (234 residues), 284.1 bits, E=3.8e-89

Best Hits

Swiss-Prot: 100% identical to HIS6_AGRFC: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 100% identity to atu:Atu0039)

MetaCyc: 50% identical to imidazole-glycerol-phosphate synthase cycloligase subunit (Thermotoga maritima)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Sequence Analysis Tools

See P58799 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Atu0039 imidazoleglycerol-phosphate synthase cyclase (Agrobacterium fabrum C58)
MTLKARIIPCLDVKDGRVVKGVNFVDLIDAGDPVEAAKAYDAAGADELCFLDITASSDNR
DTIFDVVSRTADHCFMPVTVGGGVRSVADIRKLLLCGADKVSINSAAVKDPDFVAQAADK
FGNQCIVVSIDAKRVSKDGEADRWEIFTHGGRQPTGIDAVEFAIKMVERGAGELLVTSMD
RDGTKSGYDIGLTRSIADQVRVPVIASGGVGTLDDLVAGVRDGHATAVLAASIFHFGTYS
IGEAKSYMAEHGIAMRLD