Protein Info for Atu0030 in Agrobacterium fabrum C58

Annotation: phosphocarrier protein HPr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 TIGR01003: phosphocarrier, HPr family" amino acids 4 to 83 (80 residues), 96.6 bits, see alignment E=3.2e-32 PF00381: PTS-HPr" amino acids 5 to 84 (80 residues), 90.3 bits, see alignment E=3.3e-30

Best Hits

Swiss-Prot: 52% identical to PTHP_CUPNH: Phosphocarrier protein HPr (phbH) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K11189, phosphocarrier protein (inferred from 100% identity to atu:Atu0030)

Predicted SEED Role

"Phosphocarrier protein, nitrogen regulation associated"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKS5 at UniProt or InterPro

Protein Sequence (91 amino acids)

>Atu0030 phosphocarrier protein HPr (Agrobacterium fabrum C58)
MSPLSRELPIINKRGLHARASAKFVQMVEGFDATITVSKDGMTVGGTSIMGLMMLAASPG
CSVYVEASGNQAVEALAALEALVANRFGEEA