Protein Info for AMB_RS24645 in Magnetospirillum magneticum AMB-1

Annotation: DUF423 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 144 to 164 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details PF04241: DUF423" amino acids 161 to 242 (82 residues), 60.3 bits, see alignment E=8.8e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>AMB_RS24645 DUF423 domain-containing protein (Magnetospirillum magneticum AMB-1)
MGSPTARGRLWTPMRASALPCRRITLPAGSAAGASSVKVSSMPLWSWTCSRAPGPVCRDS
PFRMGSPAARGRRWVPSRASALPCRPMTLPAGSVARAPEASRMIPRITAASACGTGIPNS
PLCRANSLRYFVLRRGAVKEGKSMGVWLMLAGINGAMAIGFAAWGSHGVEGDAARWVALG
SQFQLLHAAALLALARHCAEGRRLFRPAACLMVAGIALFCGSLYLKALGVGLPVPMVTPF
GGISLMTSWLLLGVGGWLAGDHARI