Protein Info for AMB_RS24560 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 73 to 95 (23 residues), see Phobius details PF00512: HisKA" amino acids 140 to 204 (65 residues), 51.3 bits, see alignment E=9.9e-18 PF02518: HATPase_c" amino acids 250 to 358 (109 residues), 86.2 bits, see alignment E=2.2e-28

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>AMB_RS24560 hypothetical protein (Magnetospirillum magneticum AMB-1)
MASLYGELPQGLAFTIYDGVTLADRDVLYKSPEDAGAATVFASNEYLVVGGHTWTLAAKM
RQAFEGGPGRDTATVVAVAGIGLSLLLSSLVWLMATGRERALQLAQTMTRDLRAAKEAAE
DAQRSLAAQAHNLAQSNADLEQFAYVASHDLRTPLRNIVSYAQLLERRYKGHLGADANDF
IDFIVENSKKMTLLISDLLEYSRVSRQAAPLEPVSVARALHLAMGNLRPDLEGCGAEIRI
GALPEVLAVETYLVSLFQNLIGNAVKYRSRERPLQIAIAAERTGSDLWRFSLADNGIGIE
PAYHDKIFEIFQRLDPSGDAEGTGIGLTLCRRIVHRFGGTIWLESEMGRGSTFFFTLRAV
STPRASFSSTTT