Protein Info for AMB_RS24005 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 TIGR00229: PAS domain S-box protein" amino acids 14 to 135 (122 residues), 54 bits, see alignment E=9.2e-19 amino acids 137 to 262 (126 residues), 62.3 bits, see alignment E=2.5e-21 PF00989: PAS" amino acids 25 to 125 (101 residues), 32.3 bits, see alignment E=3.4e-11 amino acids 141 to 255 (115 residues), 43.3 bits, see alignment E=1.3e-14 PF13426: PAS_9" amino acids 26 to 127 (102 residues), 41.3 bits, see alignment E=6.6e-14 amino acids 164 to 257 (94 residues), 28.9 bits, see alignment E=4.7e-10 PF08448: PAS_4" amino acids 28 to 128 (101 residues), 26.3 bits, see alignment E=2.9e-09 amino acids 148 to 259 (112 residues), 32.8 bits, see alignment E=2.9e-11 PF08447: PAS_3" amino acids 163 to 252 (90 residues), 82.6 bits, see alignment E=7.8e-27 PF00512: HisKA" amino acids 279 to 343 (65 residues), 43.6 bits, see alignment E=1e-14 PF02518: HATPase_c" amino acids 388 to 497 (110 residues), 99.1 bits, see alignment E=8.2e-32

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to mag:amb1109)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8B2 at UniProt or InterPro

Protein Sequence (504 amino acids)

>AMB_RS24005 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MQETATERHPDLAETKFARVFAVCPDIITITALATGRYLDVNDAFTRVMGYGRDEVIGRT
SSDIGIWETPQERQRLLEALSTSTRLENFAVRIRRKDGEVVDALLSAERTVLDGEDCLII
VGRDISDRIQVEKALSDSETRFRLAMEASNDGLWDWDIQTDQAYFSPAYFRMLGYEPGEL
PAAGRTWRDLLHPEDRQGAEAAACDCIEGRSESFSAEFRLRARNGGWRWVLCRGRAFGRD
PDGRASRLIGTHLDITEHKKFEDILSEKNRALERSNADLEQFAYVASHDLQTPLRNIVRY
AQLLELRYRSRIDADADDFIGFIVDSGKHMARLINDLLEFSRASRQAAPLAPIPVGEAVA
QALKNLELDLSKAGGEVEIGDMPVVMADQVHLVSLFQNLLGNAVKYRAPDRGLRLSVTAE
RAPGGFWRFAVADNGIGIDPEYHEKIFEIFQRLNPASDADGTGVGLALCRRIVHRFGGTI
WLQSEPGRGTTFFFTLRDGAAGPS