Protein Info for AMB_RS23855 in Magnetospirillum magneticum AMB-1

Annotation: PDZ domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 767 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00089: Trypsin" amino acids 120 to 283 (164 residues), 57.3 bits, see alignment E=6.2e-19 PF13365: Trypsin_2" amino acids 120 to 259 (140 residues), 101.4 bits, see alignment E=2.4e-32 PF18509: MCR" amino acids 321 to 348 (28 residues), 42.7 bits, see alignment (E = 1e-14) amino acids 369 to 397 (29 residues), 45.9 bits, see alignment (E = 1.1e-15) amino acids 419 to 447 (29 residues), 52.1 bits, see alignment (E = 1.2e-17) amino acids 468 to 496 (29 residues), 53.9 bits, see alignment (E = 3.3e-18) PF00595: PDZ" amino acids 555 to 619 (65 residues), 40.2 bits, see alignment E=1.1e-13 amino acids 691 to 755 (65 residues), 27.3 bits, see alignment E=1.1e-09 PF13180: PDZ_2" amino acids 562 to 630 (69 residues), 49 bits, see alignment E=1.8e-16 PF17820: PDZ_6" amino acids 567 to 621 (55 residues), 46.3 bits, see alignment 8.5e-16

Best Hits

Predicted SEED Role

"Magnetosome protein MamE, trypsin-like serine protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (767 amino acids)

>AMB_RS23855 PDZ domain-containing protein (Magnetospirillum magneticum AMB-1)
MLMGVIALIVLFGAFIYRQPSGGLRLESILEQLGHGSSVNLPTQPGAVARLQPNTGGVPR
ALASSGGGFSNVAALLRNGIVSVKASSPSRQPALGNFALDHQSTTPRFANPSASFVDSVG
TGVIVRDEGFIITNFHVVRGAQSVFVTVPDDTGSTRYSAEIVKLDEALDLALLKITPKAQ
LSVAVLGNSDAVLVADEVIAIGTPFGLDMSVSRGIISAKNKSMVIEGVTHSKLLQTDAAI
NQGNSGGPLVIANGTVIGINTAIYTPNGAFSGIGFAVPSNQARQFAQEVVGWLPTTTAEG
PSMGLVALQGPSRIGVGSAGPPIMARMSSPHTDGRQNLDCANCHEILPSNPGVAAAGSLM
PVANPRLPPPIRAIATPPHTDGRQNMACNTCHQIIGAPAGRVAFTQPMIPIVAGQPAGPS
IQANAANPHTDGRQSMNCASCHQIVGASAGPIAFVQSMPIVAQQQSGPPIQANAANPHTD
GRQSMNCVNCHQIIGAVSGSVAIGQPGLGGYQFAQPPGSLAMNVKVPRGGQAARETYPNH
NLLGAFMPPMSQLMGGQINVPAGRGVFITGVSPNTPAAAAGLQAGDMLLKVDGRPVNSAR
EVIAIISEMPNGRSVRLGILREGSVSNLTLLVGPTAAAPPAPKQNAGAGNNNVVQPAAPA
KPAKPPKIPTEFTWMGMEIDGFMEQPMMSGSPDEPPIKTTGAQVAEMATGSRAEAAGVMP
NDLILEVNNMPVTTPALLDAAIKAAKTAGPEVLLRVNRSGREVWVVL