Protein Info for AMB_RS23730 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details PF08269: dCache_2" amino acids 59 to 353 (295 residues), 250.9 bits, see alignment E=5.6e-78 PF17200: sCache_2" amino acids 101 to 245 (145 residues), 112.4 bits, see alignment E=7.2e-36 amino acids 250 to 356 (107 residues), 66.8 bits, see alignment E=7.7e-22 PF17201: Cache_3-Cache_2" amino acids 262 to 356 (95 residues), 42.2 bits, see alignment E=2.3e-14 PF13188: PAS_8" amino acids 425 to 476 (52 residues), 20.6 bits, see alignment 1.1e-07 TIGR00229: PAS domain S-box protein" amino acids 426 to 534 (109 residues), 34.9 bits, see alignment E=7.2e-13 PF00512: HisKA" amino acids 549 to 615 (67 residues), 43.7 bits, see alignment E=8.2e-15 PF02518: HATPase_c" amino acids 660 to 771 (112 residues), 100.3 bits, see alignment E=3.1e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1410)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7G1 at UniProt or InterPro

Protein Sequence (773 amino acids)

>AMB_RS23730 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MTFLHHSDTDGRFTGGADVGFSFDEKAISRVHLIGTVLVVGCLVLGLGFFFVRQITAEAE
DAIRALEVQELQKSQDLLVQQVETAKGFLTTLRLQTEEVLKHEIREQVDEAHALAQAIYD
QEKGRRSEEDIKRLITEALRPLRFFDGKGYFFIDGMDGSCVLLPIGPSREGSSLLNNRDD
TGHYIMRGLIEAARKPVGEGYSRYRWYAPGDPEKMAAKIAYVRHFAPFDWLIGTGQYVAE
VEDRLKVSALDRIRLFRFGRDASGYIVVIDDRERILVSPSRPWNEGKTVSDLEPEQRNAA
RPIVEQGRKGDGFIRYDWAREGGSGAVSTKLSYVSRLEDWNWTLAAGVYLDEISVKSDER
RAALARSIEDKRKLTLAALAIGLGVALAAGIFFSRLVARLVARYKLDLTHQNDQLRRSAR
DLFLINSIVDSSAELAFLADGEWNLIYANPFALEKLGWSLDQMSGRRLDAIADSLAVPAA
DGDRHSWRFEAALPTHDGRALPVEVLARDLLHEGVLYHVALARDITERQRWEADLCAKTA
QLEHSNADLEQFAYVASHDLREPLRMVSSYLSLLERRYGQLLDSDGLEFLGFAKDGAQRL
DRLVLDLLEFSRIDRRGSPLAPMPVRPAVDVAARNLSVAMAEGGATLVLEDALDRAVVLG
DSGQITRLLQNLIGNAIKYRSDGRPPRIVIGCRRDGACWELSVSDNGIGIEPQYFERIFG
IFQRLHTRDRFEGTGIGLAIAKKIVERHGGRIWVDSRPGEGSSFHFTLPAAAA