Protein Info for AMB_RS23720 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details PF00672: HAMP" amino acids 308 to 361 (54 residues), 44.4 bits, see alignment 1.7e-15 PF02518: HATPase_c" amino acids 651 to 757 (107 residues), 87.8 bits, see alignment E=6.7e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1111)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8B0 at UniProt or InterPro

Protein Sequence (768 amino acids)

>AMB_RS23720 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MISRISVSGKLLLIYALDMVAVIFLGFSLAEEKYISINFARKEVAGNVYIDTVRDALFAI
AEDGTVTVGQLAALERAEGLYGPEMSSRIASDDLLASSRPLATASPQRTDAAALKAVTSA
RALISRIGDQSNLILDPDLDSYYSMSLVLLRFPELVDLLAQIRAQAHRSVHDGAISADDR
TEFLILEGRLTNVIKGIEGDRLAGYSGNPDGSLERALKPAFALLDTALSGLLADLRASII
DQSGPIQAEPVSRAIDTSLQATKVVWVQTSSELNRLLNIRIEGFFRRMWEHFGLAGALLS
VILILVLLVARRIAVPIGHLAEVAEAVRQTNDYDRRAKWDSGDEIGRLVDAFNTMLERLQ
AEGLRREELAAQTRAAEAQRDLLEAIPTPLTVSRLSDHSLLHVNQPASLLLGLLDSYDAV
EDHLSAEDRERLFQQLSLHGAVNEFEVQVMGAGDVPFWALMSARLLVYQGEKALLATIIP
ISERKRMEDELLRAKNAAEAALSDLQQAQQSLIQAEKMASLGGLVAGVAHEINTPVGIGL
TGASTLASETERLRKLYGEQAMTEEDFLDYLGVAAETARLLLANMNRAAELIHSFKQVAV
DQTSAERRRFDLKTYIEEILNSLTPTIKKRRLGVEVSCPDGIEMNSYPGILSQVLTNLVM
NAVVHAYEENQAGILGIRVQDLGDEVLLAFSDDGKGISAENLSRIFDPFFTTRRGNGGSG
LGLHIVFNVVTGSLNGQIDVASEPGRGTTFTLRFPKTVRSPLLEDMPA