Protein Info for AMB_RS23435 in Magnetospirillum magneticum AMB-1

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 217 to 383 (167 residues), 150.9 bits, see alignment E=1.3e-48 PF00990: GGDEF" amino acids 221 to 380 (160 residues), 135 bits, see alignment E=2.2e-43 PF22335: Cas10-Cmr2_palm2" amino acids 299 to 380 (82 residues), 27 bits, see alignment E=4.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2530)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W491 at UniProt or InterPro

Protein Sequence (386 amino acids)

>AMB_RS23435 GGDEF domain-containing protein (Magnetospirillum magneticum AMB-1)
MILDLHTMLVAVAVATACCAIARIVLYILHPGLAGLGYWAWASVIGAASFAVAGTGAGMP
EGWSLSLAHGLVVAGFCLVWDGFRRFLGRPGLTSRFYLGLGGAAVVMIVGSHLAGSLHLR
ATFNSALVMAISAAIARELLWRTPPHRLAMRLAGWVYFANALFFLVRGLSIGFDLEFMAG
KMSYGMTVVASMWWLCVTISVTLCMVLMASERLQADLNEQASRDPLTGALNRRAFASLGE
REIVRARRTASPLSLLMIDMDHFKQINDCLGHGGGDEVLVLFATLAGRILRAEDLFCRFG
GEEFLALLPSSSLMEAMGVAERLRAAFSAEGAGLDSEGKLPFPMTLSVGIAALAADEDME
AAIRRADAALYRAKDLGRNRCELAGG