Protein Info for AMB_RS23380 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 964 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details transmembrane" amino acids 283 to 300 (18 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF02743: dCache_1" amino acids 69 to 289 (221 residues), 49.2 bits, see alignment E=2.2e-16 PF00672: HAMP" amino acids 324 to 376 (53 residues), 26.3 bits, see alignment 3.5e-09 TIGR00229: PAS domain S-box protein" amino acids 391 to 509 (119 residues), 76.8 bits, see alignment E=1.6e-25 PF13188: PAS_8" amino acids 393 to 436 (44 residues), 30.4 bits, see alignment 1.2e-10 PF00989: PAS" amino acids 395 to 501 (107 residues), 49.7 bits, see alignment E=1.5e-16 PF08448: PAS_4" amino acids 396 to 505 (110 residues), 32.1 bits, see alignment E=5.4e-11 PF13426: PAS_9" amino acids 401 to 503 (103 residues), 65 bits, see alignment E=2.9e-21 PF08447: PAS_3" amino acids 413 to 497 (85 residues), 35.6 bits, see alignment E=4.2e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 513 to 675 (163 residues), 132.8 bits, see alignment E=1e-42 PF00990: GGDEF" amino acids 515 to 673 (159 residues), 139.3 bits, see alignment E=4.5e-44 PF00563: EAL" amino acids 693 to 946 (254 residues), 238 bits, see alignment E=4.6e-74

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1918)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W603 at UniProt or InterPro

Protein Sequence (964 amino acids)

>AMB_RS23380 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MLMNRHVERRQMIHAMSAVFQNLDLKTKIVAACVGLFVAAIWLLAHDVAEEVRDDVKAVV
AAEQTALVEHITDSLEEESKLRINTLKDVASLISPEMMGDRERLGAKLAEFKHIGRLFNL
GLSVVSRQGIGFVDFPALKGRAGSDFSGEDYFPAIMAGEEVAIGRPRLGRFSNRPVVLLA
VPIRGAANEVIGVLVGANSVSDSDFFTEIIPRQSRLDGEFHIVSPRDRLYVASTRKDRIL
QPLPASGVNHMLDRYVEGYEGSGLSINSEGMEVLSSSRRIESTGWAVIATIPTSVAFAPI
RRLEFEIYQDAALASVIIAVLLWLFVRRQLRPLEHAAGMLNAMATGSRPLSPLPVEGGPE
IRQMLDSFNKFHERIKAQKQSLRDNAEQLQLAASVFDGTSEAIAITDAEGLIVSVNKPFC
RLTGYELEELVGRNPNILKSGRHDSDFYAEMWRSITATGNWSGEVWNRRKNGEVYPERLT
ISTIYDAKGQIQRRVAIASDITEQKKAEEIIWHQANHDLLTGLPNRRRFLDLLRKDLARA
DSLPDMVVGVLLIDLDRFKEVNDTLGHAIGDQLLLEVARRIRSCLSEKDVIGHLGADEFI
VSMIDDLSTTRLEAAVAAIRMVIAEPFRSGSDTLHLTASIGITAYPTDGGDMEELLRNVD
QAVREAKNGGRDRSCCFTESMREAGQTRLQLANDLREALSEGQFEVYYQPIIDMPSRAIV
KAEALLRWRHPERGFVSPTIFIPIAEETGLICDIGNWVFRQAAATARRLCDSCRYVVGGI
CRKDDIAGPSTPCRFQIAVNKSPRQFFSGFSHLEWAEHLRELNISPQCISIEVTEGLLLG
QHAEVMERLTKFRAAGMQIALDDFGTGYSAMSYLKRFDIDYIKIDQSFVRDMTVDSSDRA
IAEAIIAMAHRLGMKVVAEGIETEEQYALLAAAGCDFGQGYLFAKPMPVDQFEALVGDLT
DEKC