Protein Info for AMB_RS23300 in Magnetospirillum magneticum AMB-1

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 744 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 71 to 258 (188 residues), 74.6 bits, see alignment E=4.4e-25 PF02195: ParB_N" amino acids 71 to 179 (109 residues), 53.7 bits, see alignment E=2e-18 PF17762: HTH_ParB" amino acids 182 to 268 (87 residues), 30.9 bits, see alignment E=2.5e-11

Best Hits

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to mag:amb1502)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB / Stage 0 sporulation protein J" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W769 at UniProt or InterPro

Protein Sequence (744 amino acids)

>AMB_RS23300 transcriptional regulator (Magnetospirillum magneticum AMB-1)
MGKQKLTPEQEREIYDLRQATPAPSFAEIGTRFGVDKSAAVRAYARAEAAIAAKAGPSLP
AQAPAVVPMGVSAAPHDRIAPSPLNPRQRIDEDELTKLVDSVRIEGVLLPLLVRYARQAF
TQPTDPRVEYEIIAGERRWQATRRLIDAGERPADTPLPIRLIDPCDDAKLLELALTENVA
RKDMTPWEEAEAFEKLRKLGRSAAEIAATVGMVKRTVEMRLRLVRDLDVAAKDALRDGRI
TVEAANILAAFCPLPSQSLALDQIAKGSFPTTRDLKRYLTQSLIPTTVAFFPPAEYTGEL
IADESDPNVAYFADAKLFEKLQQKAIAEAEIKARAKGYAWTRVIDGRKPGEYFSSWDWET
DKKDPARGVVYEIKGNGLVVVHTDLVSKAERTKQAASAAGLTGDAPAEQSSSVTKGHYCH
ARRRKTVALQTALSRSPVMAMRAACLALIGCGENVRIRTEHLGADDKAWSQDVEDTIAHY
LPRFADAAKKGFEIAAGDVRRKDWGEADNGAAWGALAAMTDAEVGEFFAALVALRVGSFA
TYSPEAGDRPAVVGMARSLGLIGAEEAHGLTLLPEDLDGLRKPALLDVWAQVSPNSDAPD
VGGIKGLREDIVCQAPPTYVLPSLRFGLKAEIEAALKATPPAGPDPRQIDLEEAIAAKGV
RDISLETIVAALAPVIDNPFAPTGETPLFELVPEARIEAAAGTLARAFGLPSITPDVLLT
IEDLDHLALVLENHRAALATGEAA