Protein Info for AMB_RS23285 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 10 to 114 (105 residues), 39.1 bits, see alignment E=1.9e-13 PF13439: Glyco_transf_4" amino acids 313 to 465 (153 residues), 34.4 bits, see alignment E=5.5e-12 PF20706: GT4-conflict" amino acids 475 to 587 (113 residues), 29.5 bits, see alignment E=1e-10 PF00534: Glycos_transf_1" amino acids 483 to 638 (156 residues), 64.4 bits, see alignment E=2.4e-21 PF13692: Glyco_trans_1_4" amino acids 488 to 625 (138 residues), 62.4 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1442)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7C9 at UniProt or InterPro

Protein Sequence (663 amino acids)

>AMB_RS23285 hypothetical protein (Magnetospirillum magneticum AMB-1)
MIGRCLVALLACHNRRTVTRAALETLFRQALPPDLSLDVILVDDGSSDGTFETVAERFPS
VRLLRGDGSLYWNGAMALAQKAAMADAADAHLWLNDDVVLAENAIADLLAVHDGEIAAGR
RPPIVVGAMVDPESGCPTYGGHVRRPGLHPFRFARVFASGQAATPCDSFNGNCLLVPRSA
FGVLGPIDDAFAGGQPLGDIDYGLRAGRAGIPMLVAPRPAGRCKANHGGSPWETPGRPLG
ERLASLSGPLGPARRQTATFYRRHGGWAWPFWWATHVGRCLWAGFRPRARRRERPRLAMI
EPVLPWYRLPLLTRLRDSGQIDVEVFHGTSHPEGEPDCDPPPAIRHHRSRNFYWPRGGDR
ILWCNGVWKVLFGGYDVVLMAEHVYTASNWLIWLASRLLGRPRIILTGHFNLDAKPENLI
ARLRRAWIRGADYLAAYTSSGERQCRAIGIPLHRIEVLGNTLDVEAIRTQAASVQGTRPA
PAEGGPAVFLFIGRLYRDKMAPLAAEAVATLNGMGHPALLLVVGEGSDRAELERLAREGS
PVRVLGECRDPADLARLFAQAQAAIMPDAAGLAVVHAFAHGIPVVIGPGSRHRVEVEYLR
HGENGLRAEALTARSLAEQMRRLLTEPGLADALRAGAERTADGLSMDLYAQRLEALVARA
ARD