Protein Info for AMB_RS23160 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 PF12860: PAS_7" amino acids 16 to 131 (116 residues), 115.3 bits, see alignment E=6.2e-37 amino acids 145 to 258 (114 residues), 29 bits, see alignment E=3.6e-10 TIGR00229: PAS domain S-box protein" amino acids 135 to 260 (126 residues), 69.8 bits, see alignment E=3.5e-23 PF13188: PAS_8" amino acids 139 to 171 (33 residues), 21.7 bits, see alignment (E = 5.3e-08) PF00989: PAS" amino acids 140 to 250 (111 residues), 33.7 bits, see alignment E=1.2e-11 PF08448: PAS_4" amino acids 144 to 254 (111 residues), 41.8 bits, see alignment E=4e-14 PF13426: PAS_9" amino acids 149 to 252 (104 residues), 35.8 bits, see alignment E=2.9e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 295 to 455 (161 residues), 152.8 bits, see alignment E=1e-48 PF00990: GGDEF" amino acids 299 to 452 (154 residues), 143.1 bits, see alignment E=2.4e-45 TIGR02481: hemerythrin-like metal-binding domain" amino acids 478 to 599 (122 residues), 79.3 bits, see alignment E=3.9e-26 PF01814: Hemerythrin" amino acids 486 to 600 (115 residues), 45.7 bits, see alignment E=3.2e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>AMB_RS23160 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MLASSPECRHIIQSIIDHLPCGVTLFDQNLEMIACNGLFRRLLDFPDQLFEGSLPSMKSL
AMFNARRGEYGPGDPEELAGQVVQRAMAMKPHQFERVRPDGTILEISGQPLPSGGFITLY
TDITERREAEETLRDKEGLLRLIFDNSSVAIFTIDSSGRIGAANQRMAEMFMMPLELLVG
MEYVDLVDPVEQETARKNMADHLVQDRANVNLERHYWRSNGTAFWGQLTARHMPAYKDGR
AGLVCVVSDITERKIAEQHLAERSHELEILNLELTKAVEALAASNAELVAAREELEQLAQ
HDNLTGTWSRRRIEESAQQEMLRKTRYGHPVSLIFIDLDHFKRVNDGHGHAAGDEVLKTF
CDIAQKCMRSTDLLGRWGGEEFVIVTPNSGLMIAILLAERIRKAIMAYEFQGIGHVTASF
GVAEYRENESWESWLCRSDAALYAAKEGGRNRVVTDACEADEADEAELLDLSFLRLVWRS
TYESGHALLDTQHRNLFEHANNLLTAVIGERPTDEVAPQIEALVADLLDHFRDEEAVFRS
IGYSGADEHAQTHKGLIDRAGELVANFTSGELALGDLFNFLAYDVVAKHMLSEDRKFFGQ
IQVIRDTAG