Protein Info for AMB_RS23115 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details PF00672: HAMP" amino acids 182 to 230 (49 residues), 29.5 bits, see alignment 7.9e-11 PF07228: SpoIIE" amino acids 336 to 541 (206 residues), 122.5 bits, see alignment E=2.2e-39

Best Hits

KEGG orthology group: K07315, sigma-B regulation protein RsbU (phosphoserine phosphatase) (inferred from 100% identity to mag:amb0438)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WA83 at UniProt or InterPro

Protein Sequence (554 amino acids)

>AMB_RS23115 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MTSRLRGLTAKQAVVTVAVVLVLSAAGGMVELFFDWHAKRSQVQAQVSQIIGAIDGSAVE
AAYQLSPQLAERVVEGLLDYEIIQAARLQDNFGDLLAERRREGQAAATSRLAELLFGDIL
VYRRDLVRLGAVGKTDVGRLEVRLSPQAVASDFYARGRVNVALGLARALGIVALVVGIFY
AMITRPLLRLAQAVTRVDPGQPGRHLVPALAGHGHDELGELVDSLNALLTSSQRGLNERD
AAQAELMALTHDLERRVAERTREVEAANEEIRSLNLILKAENVRMGTELDVSRRIQQMVL
PTAGELAAIGGLDVATYMEPANEVGGDYYDILHGENGRVRFGIGDVTGHGLESGVVMLMT
QSAVRTMITGDEDGAERVLDVLNRTIFNNIQRMGSDKNLTLALLDYRPGPPDGETDPGIS
SHMRISGQHESVIVARQGGAIELIDTMDLGMPLGLVDEIGCFVNEVTVALRPGDTVILYT
DGITEAADDRHRLYGLDRLCDVISANWQRPAEAIKDSIIADVKAHIGAQPLYDDLTLIVF
KQIAERPALAEPVN