Protein Info for AMB_RS23035 in Magnetospirillum magneticum AMB-1

Annotation: protoporphyrinogen oxidase HemJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03653: UPF0093
  • amino acids 5 to 145 (141 residues), 203.7 bits, E=8.6e-65
• TIGR00701: TIGR00701 family protein
  • amino acids 6 to 145 (140 residues), 179.7 bits, E=1.7e-57

Best Hits

Swiss-Prot: 48% identical to Y883_RICPR: UPF0093 membrane protein RP883 (RP883) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K08973, putative membrane protein (inferred from 100% identity to mag:amb4552)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Biosynthesis of alkaloids derived from shikimate pathway
• Limonene and pinene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

See Q2VYG9 at UniProt or InterPro

Protein Sequence (145 amino acids)

>AMB_RS23035 protoporphyrinogen oxidase HemJ (Magnetospirillum magneticum AMB-1)
MLSGTAYLWVKAVHVIAIISWMAGLLYLPRLFVYHTTVKPRSETSETFKIMERRLIKAIM
TPAMVLAWILGLVMAVDGGLFSQGWFHLKLACVVAMTIAHFFLARCKDGFAEDRNTRSEK
FYRVINEVPTLLMIVIVIVVIVKPF