Protein Info for AMB_RS22995 in Magnetospirillum magneticum AMB-1

Annotation: protein-export protein SecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 TIGR00809: protein-export chaperone SecB" amino acids 9 to 144 (136 residues), 134 bits, see alignment E=1.8e-43 PF02556: SecB" amino acids 10 to 146 (137 residues), 163 bits, see alignment E=2.1e-52

Best Hits

Swiss-Prot: 100% identical to SECB_MAGSA: Protein-export protein SecB (secB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 100% identity to mag:amb4544)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYH7 at UniProt or InterPro

Protein Sequence (155 amino acids)

>AMB_RS22995 protein-export protein SecB (Magnetospirillum magneticum AMB-1)
MTDAQTPSEDLPQLQVNMQYIKDLSFEIPGAPHSFIEMQGKNPEIPIHVDVNVGNVGANA
YEVVLHLKIEALLDGKALFILELAYAGVFTLNLPEEQIHPVLLIECPRLLFPFARNIVAD
MTRDGGLPPLLLQPLDFVELYRARAAEMNAQQGQA