Protein Info for AMB_RS22990 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 95 to 101 (7 residues), see Phobius details PF04186: FxsA" amino acids 9 to 112 (104 residues), 93.8 bits, see alignment E=3.7e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>AMB_RS22990 hypothetical protein (Magnetospirillum magneticum AMB-1)
MAWAFLVGLLTLPVAEVLVWIRVADAIGGLATVGLTVLAILAGSALLRGGGLGLALDLRA
RLERGEPPGPIVFDGICIAFAGFLLMLPGFISDGLALLLLLPPVRALLLRAVVVSPGPAS
PSDPTIIEGEYEILSPEPDPNQPPDHKRLEP