Protein Info for AMB_RS22955 in Magnetospirillum magneticum AMB-1

Annotation: ATP-dependent protease ATPase subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 7 to 442 (436 residues), 587.1 bits, see alignment E=1.2e-180 PF07728: AAA_5" amino acids 54 to 90 (37 residues), 25.3 bits, see alignment 4e-09 PF00004: AAA" amino acids 55 to 107 (53 residues), 28.8 bits, see alignment 4.6e-10 amino acids 235 to 330 (96 residues), 27.1 bits, see alignment E=1.5e-09 PF07724: AAA_2" amino acids 188 to 327 (140 residues), 85.3 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 76% identical to HSLU_RHOCS: ATP-dependent protease ATPase subunit HslU (hslU) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to mag:amb4537)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYI4 at UniProt or InterPro

Protein Sequence (442 amino acids)

>AMB_RS22955 ATP-dependent protease ATPase subunit HslU (Magnetospirillum magneticum AMB-1)
MSAAAFSPREIVSELDRFIVGQNDAKRAVAIALRNRWRRQQLSESLREEVLPKNILMIGP
TGVGKTEIARRLARLAQAPFLKVEATKFTEVGYVGRDVEQIVRDLVEVAILMTRERLRKQ
VTAKAEIAAEERLLDALVGETAGTETRQKFRKMLREGALDAKEVEIQVAETGGAGLPTFD
IPGMPGSQVGMINLGDMLGKALGGGRTRPRKLPVPEALDVLTAEESDKLLDQDKVVKDAI
WAVENHGIVFIDEIDKICARSSEHHVGGDVSREGVQRDLLPLIEGTTVATKHGSVKTDHV
LFIASGAFHLAKPSDLLPELQGRLPIRVELKALSRDDLVRILTEPEASLLKQYEALLATE
EVTLTFEPGSVDAIADLAAEINATVENIGARRLQTVMERLLEEISFTAPDQPPGTTVTIT
AEMVRERVGELAKTADLAKFIL