Protein Info for AMB_RS22950 in Magnetospirillum magneticum AMB-1

Annotation: HslU--HslV peptidase proteolytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF00227: Proteasome" amino acids 10 to 180 (171 residues), 81.9 bits, see alignment E=2.5e-27 TIGR03692: ATP-dependent protease HslVU, peptidase subunit" amino acids 12 to 182 (171 residues), 272 bits, see alignment E=8.5e-86

Best Hits

Swiss-Prot: 100% identical to HSLV_MAGSA: ATP-dependent protease subunit HslV (hslV) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 100% identity to mag:amb4536)

MetaCyc: 59% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYI5 at UniProt or InterPro

Protein Sequence (182 amino acids)

>AMB_RS22950 HslU--HslV peptidase proteolytic subunit (Magnetospirillum magneticum AMB-1)
MSESSLPSWHGTTILCLRKDGRVVIAGDGQVSLGATVIKGNARKVRKVGGGSILVGFAGA
TADAFTLLERLEAKLEKHPGQLTRACVELAKDWRTDRYLRRLEAMMAVADKDVSLVLTGQ
GDVLEPEDGIIGIGSGGNYALAAARALIDIDGLDAETIARKAMAIAAGICVYTNGNMIVE
SL