Protein Info for AMB_RS22940 in Magnetospirillum magneticum AMB-1

Annotation: imidazoleglycerol-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00475: IGPD
  • amino acids 31 to 174 (144 residues), 231.8 bits, E=1.5e-73

Best Hits

Swiss-Prot: 100% identical to HIS7_MAGSA: Imidazoleglycerol-phosphate dehydratase (hisB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01693, imidazoleglycerol-phosphate dehydratase [EC: 4.2.1.19] (inferred from 100% identity to mag:amb4534)

Predicted SEED Role

"Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 4.2.1.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.19

Sequence Analysis Tools

See Q2VYI7 at UniProt or InterPro

Protein Sequence (199 amino acids)

>AMB_RS22940 imidazoleglycerol-phosphate dehydratase (Magnetospirillum magneticum AMB-1)
MRKAAITRNTNETSIKVAVDLDGSGKYAVSTGVGFLDHMLEQLSRHSLMDLEVDAKGDLH
IDAHHTTEDVGIAIGQAVNQALGDRKGICRYGSAYVPMDEALTRVALDLSNRPYLIWKVA
FGRDKLGTMDTELFKEWFQAFAQAAGATLHVESLYGDNDHHIVESCFKALARALREAVEI
DPRKADAVPSTKGTLGGSL