Protein Info for AMB_RS22915 in Magnetospirillum magneticum AMB-1

Annotation: histidine triad nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 7 to 109 (103 residues), 59.7 bits, E=3.9e-20
• PF01230: HIT
  • amino acids 14 to 112 (99 residues), 95.8 bits, E=2.1e-31

Best Hits

Swiss-Prot: 74% identical to YHIT_AZOBR: Uncharacterized 13.2 kDa HIT-like protein in hisE 3'region from Azospirillum brasilense

KEGG orthology group: None (inferred from 100% identity to mag:amb4529)

MetaCyc: 43% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

See Q2VYJ2 at UniProt or InterPro

Protein Sequence (122 amino acids)

>AMB_RS22915 histidine triad nucleotide-binding protein (Magnetospirillum magneticum AMB-1)
MAYDSNNIFARILRGEIPCKKVHEDDHTLAFHDINPQAPVHILVIPKGAYVSMDDFSARA
TDVEIAALVRAVGKVAEMAGVTADGWRMLSNIGENGHQEVPHLHIHVFGGRKLGHMLPKT
GA