Protein Info for AMB_RS22800 in Magnetospirillum magneticum AMB-1

Annotation: glutathione synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR01380: glutathione synthase" amino acids 3 to 309 (307 residues), 427.1 bits, see alignment E=1.7e-132 PF02951: GSH-S_N" amino acids 4 to 120 (117 residues), 151.9 bits, see alignment E=1.2e-48 PF02955: GSH-S_ATP" amino acids 124 to 295 (172 residues), 242.7 bits, see alignment E=2.6e-76 PF08443: RimK" amino acids 135 to 307 (173 residues), 62.7 bits, see alignment E=5.4e-21

Best Hits

Swiss-Prot: 67% identical to GSHB_BRUME: Glutathione synthetase (gshB) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 100% identity to mag:amb4506)

MetaCyc: 44% identical to glutathione synthetase (Escherichia coli K-12 substr. MG1655)
Glutathione synthase. [EC: 6.3.2.3]

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYL5 at UniProt or InterPro

Protein Sequence (314 amino acids)

>AMB_RS22800 glutathione synthase (Magnetospirillum magneticum AMB-1)
MSLAVAIQMDPIESIDIDADSTFVLALEAEKRGHTLFHYLPRDLALREGRVLARVRPLSV
RRAKGDHFTLGEARTVDLSSMDVVLMRQDPPFDMAYITATHLLDHIHPRTLVVNDPTHVR
NSPEKLLVTHFGDLMPPTLITSDREQIMDFREEHKDIIVKPLFGNGGAGVFHLVPGDENL
NSLLEMFTQIYREPVMVQRYLPEVRQGDKRIVLVDGVAVGAVNRVPAEGEARSNLHVGGT
AKPSILTAREHEICAAIGPTLKERGLIFVGIDVIGDYLTEINVTSPTGIQQIDRFDGVCI
EGLIWDAIELRRSV