Protein Info for AMB_RS22785 in Magnetospirillum magneticum AMB-1
Annotation: YraN family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y4503_MAGSA: UPF0102 protein amb4503 (amb4503) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
KEGG orthology group: K07460, putative endonuclease (inferred from 100% identity to mag:amb4503)Predicted SEED Role
"Predicted endonuclease distantly related to archaeal Holliday junction resolvase"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2VYL8 at UniProt or InterPro
Protein Sequence (129 amino acids)
>AMB_RS22785 YraN family protein (Magnetospirillum magneticum AMB-1) MNSAPPSRAHQAAQRRGKVAEGLAALWLRLKGYGILAKGLKSGRGSGAGEVDLVARRGDL VAFVEVKSRATLDQAIESLTPFQRQRIERAAAAFLARRPELASCGVRFDMVLVAPWRLPR HIPDAWRID