Protein Info for AMB_RS22775 in Magnetospirillum magneticum AMB-1

Annotation: penicillin-binding protein activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 107 to 436 (330 residues), 112 bits, see alignment E=7.8e-36 PF04348: LppC" amino acids 108 to 281 (174 residues), 42.5 bits, see alignment E=5.4e-15 PF01094: ANF_receptor" amino acids 129 to 284 (156 residues), 32.6 bits, see alignment E=7.3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4501)

Predicted SEED Role

"ABC-type branched-chain amino acid transport systems, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYM0 at UniProt or InterPro

Protein Sequence (456 amino acids)

>AMB_RS22775 penicillin-binding protein activator (Magnetospirillum magneticum AMB-1)
MRRRGFFRHSAVVLPLLAAMLMVSGCQQASELPPWAGGTKPAPQAQPLPAPVPPPATAKT
LPAVRPAPVPSPAPAPAATEPQAQVATLPPADSAPAAAPARAAHQGEVRAALLLPLSGPQ
AAIGQALSNAAQLALFEIADAKFNLIPLDTKGTAEGAAAAATAAMAQGADIVLGPVFSYE
VKAAAPVVRDQAIPLLAYTTDRSVAGSGVYALGFLPGPQVARVLAHAREQGLRRIGVLAR
SDDYGRAVADAAKDAAALQGLELVAVDYYDPAATDFTQVVKRFAARKGVTSKGVAGSAYD
AVLLPDDGVRLRNIASLLSYYMSEGGAEVPRLLGTLLWDDPRLASEPALAGGWYPAPPAT
AHVAFEQRYAKAFGALPPRLGGLAGIAYDSTALAAALVRNGTGDYGSARLQNINGFAGVD
GIFRLGANGIAERGLTVKEIAPTGSREVGAAPSAFQ