Protein Info for AMB_RS22750 in Magnetospirillum magneticum AMB-1

Annotation: nucleotide exchange factor GrpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF01025: GrpE" amino acids 34 to 189 (156 residues), 172.7 bits, see alignment E=2.6e-55

Best Hits

Swiss-Prot: 100% identical to GRPE_MAGSA: Protein GrpE (grpE) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03687, molecular chaperone GrpE (inferred from 100% identity to mag:amb4496)

Predicted SEED Role

"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYM5 at UniProt or InterPro

Protein Sequence (203 amino acids)

>AMB_RS22750 nucleotide exchange factor GrpE (Magnetospirillum magneticum AMB-1)
MTQDQTAEQMPAAESADQSADQGPAAESAAPPAVDSERIKELEAEIAKLKNDVLYAKAET
ENTRRRLEQQAEDRGRYAISNIAKDVLSVADNLRRALDSVPASAREGNESLTALTTGVEM
TERELLATFERYGIKLVAAQGERFDPNLHQAMMEMEDPSQIEGTVVLVMQAGYTLHDRLL
RPALVGVAKGGPKSGGNNVDTKV