Protein Info for AMB_RS22715 in Magnetospirillum magneticum AMB-1

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 13 to 466 (454 residues), 602.9 bits, E=2.3e-185
• PF00206: Lyase_1
  • amino acids 16 to 310 (295 residues), 277.3 bits, E=1.9e-86
• PF14698: ASL_C2
  • amino acids 373 to 442 (70 residues), 85.7 bits, E=2.4e-28

Best Hits

Swiss-Prot: 100% identical to ARLY_MAGSA: Argininosuccinate lyase (argH) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 100% identity to mag:amb4489)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

See Q2VYN2 at UniProt or InterPro

Protein Sequence (471 amino acids)

>AMB_RS22715 argininosuccinate lyase (Magnetospirillum magneticum AMB-1)
MTDTDKTKAASSMWGGRFAGGPAAIMQRINASIDFDKRLYAQDIRGSKAHCRMLVKQQIL
TEADGALILDGLDKVLAEIEAGNFPFSHALEDIHMNVESRLAELIGEAAGRLHTARSRND
QVATDFRLWVRDAVDGMESALKELVTALLDRAEEHAATVMPGFTHLQTAQPVTFGHHMMA
YVEMISRDRSRLADARRRLNECPLGSAALAGTSFPIDREATARDLGFAGPMRNSLDGVSD
RDFALEFMSASAICAVHLSRLAEELVIWTSSQFRFVTLSDAFTTGSSIMPQKRNPDAAEL
IRAKTGRVIGDLNALLIVMKGLPLAYSKDMQDDKEPVFEVADTMELAIAAMTGMVRDMTV
NVDILRAAAGAGFTTATDIADWCVRALKMPFRRAHHVAGSLVKLAEGKNCGLEDLTLAEM
QAIEPGITEEARSVLSVESSVNSRTSLGGTAPVRVREAVAGARRRLMDEAP