Protein Info for AMB_RS22710 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 163 to 173 (11 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 235 to 249 (15 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details PF13000: Acatn" amino acids 19 to 97 (79 residues), 46.5 bits, see alignment E=2.1e-16 PF07690: MFS_1" amino acids 21 to 399 (379 residues), 68.7 bits, see alignment E=4.4e-23 amino acids 268 to 437 (170 residues), 35.1 bits, see alignment E=7.5e-13

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 100% identity to mag:amb4488)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYN3 at UniProt or InterPro

Protein Sequence (445 amino acids)

>AMB_RS22710 MFS transporter (Magnetospirillum magneticum AMB-1)
MSTSWRAGFAAYLDRRVMMVLLLGFASGLPLALTFSTLSAWLAAEGISRKAIGLFALVGT
PYALKFLWSPLIDRLPLPGLTRLLGRRRSWGVLIQALLIAAICGLGATDPVREIGLTAAL
ALVVAFLSASQDIVLDAYRVEILDDEQQGPGAGAVQAGYRLAMLASGAGAMLCAQTFGWF
AAYGLMAALLGLGMVVLLLGPEPQVKVSAATAERERRAEEYLAARPHLGGTRAKVVAWLY
GAVVCPFADFMTRPAWWAVLLFIVGYKMGEAMAGAMANPLYIKMGFSLAEIAYVSKIFGF
GATMAGILVGGALVTRLGVMRALLLFGVLQSLGNLAYVWQAVAGHDLWALALCVAAENLT
AGMAASALVTYLSGLCNVAYTATQYALLSSLTALGRTVFASTSGWLADALGWVDFFLLTT
VVTLPALLILPWLMRQQGRVASKPG