Protein Info for AMB_RS22655 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 319 to 336 (18 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 378 to 402 (25 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 314 (288 residues), 129 bits, see alignment E=3.1e-41 amino acids 298 to 436 (139 residues), 45.9 bits, see alignment E=5.8e-16 PF06779: MFS_4" amino acids 40 to 196 (157 residues), 40.6 bits, see alignment E=3.3e-14 PF00083: Sugar_tr" amino acids 57 to 424 (368 residues), 102.7 bits, see alignment E=3.5e-33

Best Hits

KEGG orthology group: K05548, MFS transporter, AAHS family, benzoate transport protein (inferred from 100% identity to mag:amb4477)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYP4 at UniProt or InterPro

Protein Sequence (453 amino acids)

>AMB_RS22655 MFS transporter (Magnetospirillum magneticum AMB-1)
MALVNAHKLIDEAKFGKFHWNVLFWTALIIIFDGYDLVIYGVVLPVLMKEWHLDPIQAGT
LGSYALFGMMFGALTFGSLSDRFGRKPVIAVCVVLFSLFTVLNGFVRDTTEFAICRFVAG
LGIGGVMPNAVALMTEYAPKRLRSTLVAVMFSGYSVGGMLSAGLGMTLIPVYGWSAVFFV
AAVPLLLLPVILFLLPESIGFLIKAGRTAEAADKLARLEPSYKPQPGDEISFPTGATGQA
SLPALFAGGRGVSTVMFWIAFFMCLLMVYALGSWLPKLMNNAGYGLGSSLSFLLVLNFGA
IFGAVGGGHIADRMNLKRVLVAFFVIAAISISLLGVKSPTLVLYVLVAVAGATTIGTQIL
LYAYVAQFYPMAIRSTGIGWASGVGRSGAILGPVLGGTLLAWKLPLMQNFMAFAVPGVIA
AIAMSLVVRGAQHAPEEERDLAFAAETGMMEPD