Protein Info for AMB_RS22630 in Magnetospirillum magneticum AMB-1

Annotation: inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 259 to 275 (17 residues), see Phobius details amino acids 303 to 328 (26 residues), see Phobius details PF01384: PHO4" amino acids 23 to 322 (300 residues), 304.4 bits, see alignment E=4.8e-95

Best Hits

Swiss-Prot: 70% identical to PIT_RHIME: Probable low-affinity inorganic phosphate transporter (pit) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to mag:amb4472)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYP9 at UniProt or InterPro

Protein Sequence (333 amino acids)

>AMB_RS22630 inorganic phosphate transporter (Magnetospirillum magneticum AMB-1)
MESVAFPIIVALVVTALVFDFLNGLHDAANSIATVVSTRVLSPKYAVAWAAFFNTIALVF
FTTSVAKTIGTGIVEPGLVDTHLIFGALMGAIVWNVVTWGLGIPSSSSHALIGGIAGAGI
AKGGFSALVPAGFLKTGSAIVLSPLIGLVLAMTLILIVSWLCRRTAPFVVDRRFRILQFF
SAAMYSLGHGGNDAQKTMGIIAALLYSQGMLGGEFHVPVWVAVLCQLAMGLGTLFGGWRI
VKTMGSKITDMKQVDGFCANAAGAATLFGATWLGIPVSTTHTITGAIIGVGSARKVSGVR
WGIAGNIIVAWVVTIPAAGTVAALFYWLSTHFW