Protein Info for AMB_RS22585 in Magnetospirillum magneticum AMB-1

Annotation: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF00919: UPF0004" amino acids 4 to 107 (104 residues), 101.4 bits, see alignment E=3.5e-33 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 5 to 435 (431 residues), 474.6 bits, see alignment E=2.7e-146 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 5 to 435 (431 residues), 494.8 bits, see alignment E=2.5e-152 PF04055: Radical_SAM" amino acids 155 to 324 (170 residues), 98.7 bits, see alignment E=6.6e-32 PF01938: TRAM" amino acids 379 to 436 (58 residues), 35.3 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 100% identical to MIAB_MAGSA: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 100% identity to mag:amb4463)

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYQ8 at UniProt or InterPro

Protein Sequence (438 amino acids)

>AMB_RS22585 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (Magnetospirillum magneticum AMB-1)
MAKRLFVKTYGCQMNVYDSARMADVLAPLGYGPADHAEEADMVILNTCHIREKAAEKVFS
ELGRLRKLQAAKAEAGGRMILAVAGCVAQAEGEEILRRAPFVDIVLGPQTYHRLPEMVAQ
AARAGGAVLDTEFPAEPKFDFLPEPHAEGTSAFLSVQEGCDKFCTFCVVPYTRGAEYSRP
AAAVLAEAATLAAGGVREITLLGQNVNGWHGGEGWGLGRLIRALAEVEGVERIRYTTSHP
RDMDDELIRAHAELPQLMPFLHLPVQSGSDRILAAMNRGHDRDTYLRLVDKLKSACPDLA
LSSDFIVGFPGESDADFEASMDLIRRVGFVQTYSFKYSPRPGTPAAAMETQVPEAVKDER
LAQVQALLLDQTMRFNHACVGREMRILLDRPGRHAGQLLGRSPYMQPVHVKAAAHLIGTV
VPLRITKVHPNSLEAVPA