Protein Info for AMB_RS22575 in Magnetospirillum magneticum AMB-1

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF13444: Acetyltransf_5" amino acids 31 to 137 (107 residues), 107.2 bits, see alignment E=3.3e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4461)

MetaCyc: 47% identical to L-ornithine N 3-hydroxy acyltransferase (Sinorhizobium meliloti 1021)
RXN-12431 [EC: 2.3.2.30]

Predicted SEED Role

"Putative hemolysin"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYR0 at UniProt or InterPro

Protein Sequence (268 amino acids)

>AMB_RS22575 GNAT family N-acetyltransferase (Magnetospirillum magneticum AMB-1)
MQSVSETREVVDGLEVRLAESAAEIAAAQALRYRVFYQEMGARPTEAMRARLADFDDFDA
VCDHLLVIDRARGTGAAGVVGTYRLMRRTAGERFGRFYTAGEYDISNIIANGGRFMELGR
SCVDAGYRNGATMKKLWDGIAAYVFENGVELMFGCASLPGTDIQALAGHLSYLYHHHLAP
EDLRPRALPQLHVDMALLPKEALSPRRALAELPPLIKGYLRLGGFVGDGAVIDHQFNTTD
VCVMVKTDLVTAKYRAHYDRTIPGWSEE