Protein Info for AMB_RS22505 in Magnetospirillum magneticum AMB-1

Annotation: RNA-binding S4 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 PF01479: S4" amino acids 6 to 52 (47 residues), 44.1 bits, see alignment E=6.7e-16

Best Hits

KEGG orthology group: K04762, ribosome-associated heat shock protein Hsp15 (inferred from 100% identity to mag:amb4447)

Predicted SEED Role

"Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYS4 at UniProt or InterPro

Protein Sequence (93 amino acids)

>AMB_RS22505 RNA-binding S4 domain-containing protein (Magnetospirillum magneticum AMB-1)
METSIRLDKWLFFCRFFKSRSLAANVVESGGVRLNGLPVAKPAHAVKPGDRVSFPAGPYL
RTVEVVALGTRRGPALEAQGLYRDLGKERAPEE