Protein Info for AMB_RS22450 in Magnetospirillum magneticum AMB-1

Annotation: electron transfer flavoprotein-ubiquinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF01946: Thi4" amino acids 5 to 49 (45 residues), 29.1 bits, see alignment 1.7e-10 PF00890: FAD_binding_2" amino acids 9 to 48 (40 residues), 26.7 bits, see alignment 9.6e-10 PF13450: NAD_binding_8" amino acids 12 to 52 (41 residues), 30.6 bits, see alignment 9.9e-11 PF21162: ETFQO_UQ-bd" amino acids 204 to 297 (94 residues), 150.6 bits, see alignment E=4.5e-48 PF05187: Fer4_ETF_QO" amino acids 435 to 537 (103 residues), 174 bits, see alignment E=2.2e-55

Best Hits

Swiss-Prot: 62% identical to ETFD_RAT: Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (Etfdh) from Rattus norvegicus

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 100% identity to mag:amb4437)

MetaCyc: 61% identical to electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (Homo sapiens)
Electron-transferring-flavoprotein dehydrogenase. [EC: 1.5.5.1]

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYT4 at UniProt or InterPro

Protein Sequence (540 amino acids)

>AMB_RS22450 electron transfer flavoprotein-ubiquinone oxidoreductase (Magnetospirillum magneticum AMB-1)
MERESMEFDVVVVGGGPSGLTAAIRLKQINADLNVCVLEKGSEVGAHILSGAVIETRALA
ELFPDWKEREAPLLTPATDDRFMFLTESKAIRLMTPPQMNNHGNYIVSLGNFTRWLGSQA
EALGVEIFAGFAAAEVLYNEDGSVKGVATGDMGIGKDGQPTHNHTPGVELWARQTIFAEG
CRGSLTKTLFDRFDLRKDCEDQTYGIGIKELWEIDPAKHKAGTILHTVGWPLDSQTYGGS
FLYHLENNQVAVGFVVGLDYANPHLSPFDEFQRFKTHPAIRPLFEGGRRVSYGARALSEG
GFQSIPKLTFPGGVLVGDTAGFLNVPKIKGTHTAMKSAMVAAEAVAEALGHEGGANEVVT
YPEHLKKSWVWSELHTVRNIRPSFHWGLWGGIAYSALETYVFRGKMPWTLHHQPDHLALK
KASECPKIAYPKPDGVVSFDKLSSVFISSTNHEENQPAHLKLRDPAVPVAINLEHYDAPE
QRYCPAGVYEIVRNDDGSNPRLQINAQNCLHCKTCDIKDPTQNINWVVPEGGGGPNYPNM