Protein Info for AMB_RS22445 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF14559: TPR_19" amino acids 42 to 99 (58 residues), 30.3 bits, see alignment 3.1e-10 PF09976: TPR_21" amino acids 293 to 396 (104 residues), 29.2 bits, see alignment E=5.3e-10 PF13174: TPR_6" amino acids 330 to 361 (32 residues), 15.3 bits, see alignment (E = 1.8e-05) PF13432: TPR_16" amino acids 333 to 393 (61 residues), 27.4 bits, see alignment E=2.8e-09 amino acids 368 to 435 (68 residues), 31.2 bits, see alignment E=1.8e-10 amino acids 405 to 469 (65 residues), 18 bits, see alignment E=2.4e-06 amino acids 476 to 535 (60 residues), 37.5 bits, see alignment 1.9e-12 PF13429: TPR_15" amino acids 403 to 523 (121 residues), 33.6 bits, see alignment E=1.9e-11 PF13176: TPR_7" amino acids 475 to 504 (30 residues), 17.9 bits, see alignment (E = 1.9e-06) PF13181: TPR_8" amino acids 476 to 503 (28 residues), 18.5 bits, see alignment (E = 1.2e-06) PF13414: TPR_11" amino acids 479 to 518 (40 residues), 27.3 bits, see alignment 1.6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4436)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYT5 at UniProt or InterPro

Protein Sequence (558 amino acids)

>AMB_RS22445 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MAAMVAAGLGACAPRPDASADDNAGSGNETGLGAYLAGRFAHARGDTRAAAEYYAAAARR
DPDNIDIQQRSFALLLAEGRLDEAEPIARRLLVIDDDSPLPLLVMGVQDARAGRFDLAEK
RFSALPAKGINGFLGPLLTAWARAGQGQFDDGLATLAPRADTAGFAPVWEYHAGLMGDLA
GRPDVAEAHFKAALANQTSVRTVEAAGTWYQRSGRMDEAKALYERYHAEHADRSLLDGRR
QLAAGTNLPRVVETARDGLAEALFDTSSLVRQGNAQELSLVFSRLALSLRADFPLAQLLL
ADAMVAQGRLDEANALYSAMNRASQPGAFARLKLAVNLDEMKQTDAALSELTSLAAEWPE
SPEALMTMGDVLRRHKRYAEAADAYGAALARNGGSQDARNWSLFYARGIAYERAKQWSKA
EPDMLEALRLSPDQPDVLNYLGYTWVDQGINVEKGRKLIERAVELRPNDGAIVDSLGWAL
YRMGEFQAAVKYLERASELKPEDPTVNEHLGDAFWQVGRDTEARYQWQRAMGLDPEPEQI
EPLKAKISTGRLPGTPVK