Protein Info for AMB_RS22440 in Magnetospirillum magneticum AMB-1

Annotation: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase" amino acids 4 to 265 (262 residues), 175.5 bits, see alignment E=9.5e-56 PF00288: GHMP_kinases_N" amino acids 67 to 144 (78 residues), 56.8 bits, see alignment E=2.2e-19 PF08544: GHMP_kinases_C" amino acids 201 to 272 (72 residues), 32.5 bits, see alignment E=9.6e-12

Best Hits

Swiss-Prot: 100% identical to ISPE_MAGSA: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 100% identity to mag:amb4435)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYT6 at UniProt or InterPro

Protein Sequence (285 amino acids)

>AMB_RS22440 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (Magnetospirillum magneticum AMB-1)
MTSFSIEAPAKVNLTLHVVGKRDDGYHLLDSLVVFAGIGDTLEFSPAETLSLEVTGPTAS
QIPDGENIVLKAARLLAEATGVTKGAAIRLTKRLPVAAGIGGGSADAAAALKGLMRLWGV
APPAETLRRVALSIGADVPVCLAGTPMRMMGVGEVLEPAPTLPPAWLVLVNPLVPLHTPP
VFKARTGPFSAADPLTAPPRDAKGLAEALAARRNDLTPPAITIEPVVGEVLAAIAATADC
LLPRMSGSGATCFGLYAEEAQARAAAAQLGAAHPAWWIAPAQLLS