Protein Info for AMB_RS22380 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome C4 precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 26 to 103 (78 residues), 26.5 bits, see alignment E=6.8e-10 amino acids 118 to 196 (79 residues), 27.4 bits, see alignment E=3.4e-10 PF00034: Cytochrom_C" amino acids 27 to 106 (80 residues), 34.6 bits, see alignment E=3.9e-12 amino acids 119 to 199 (81 residues), 39.8 bits, see alignment E=9.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4424)

Predicted SEED Role

"Cytochrome c553" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYU7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>AMB_RS22380 cytochrome C4 precursor (Magnetospirillum magneticum AMB-1)
MTPYAVLAAVLAALCASPALAAPSPATDGKALFAAKGCQACHGEAGAKPIAGSPVIAGQN
AIYLARQMTEIADGTRTSAPVKVMKPIIEKTTPDERKALAEWLSTQKPADPQTGDKAKAE
QGAELFDENGCIGCHGADGLKPLADYPFLAAQRKDYLMIQIKAIRDEIRSTRRTRMMTAN
VRKFSDAQVEQVAEFLSQTKRK