Protein Info for AMB_RS22285 in Magnetospirillum magneticum AMB-1

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 44 to 44 (1 residues), see Phobius details amino acids 52 to 62 (11 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 172 to 200 (29 residues), see Phobius details amino acids 205 to 232 (28 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details PF01925: TauE" amino acids 18 to 288 (271 residues), 175.6 bits, see alignment E=6.9e-56

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to mag:amb4406)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYW5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>AMB_RS22285 sulfite exporter TauE/SafE family protein (Magnetospirillum magneticum AMB-1)
MQIYLPIAEMSVNVFVILGLGGGVGFMSGLFGVGGGFLMTPLLIFLGVPPTVAVGTEANQ
IVASSVSGVLAHWRRGNVDVKMGLILTLGGFVGSTLGVYVFKWLRGLGQIDLVISLLYIV
FLGIVGSLMLVESIQALVASKRNGGNVPVRKKHQHSWMHGLPFKMRFRRSQLYISAIVPA
AIGLLVGILAALMGVGGGFIMVPAMIYLLGMPTAVVVGTSLFQIIFVTANATFLQSTMNH
TVDVVLALLLLLGGVIGAQVGARFGVKLKGEQLRSLLALMVLGVCVKLLFDMVTVPGELF
AAGTGGKH