Protein Info for AMB_RS22235 in Magnetospirillum magneticum AMB-1

Annotation: RNase adaptor protein RapZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF03668: ATP_bind_2" amino acids 24 to 303 (280 residues), 284.5 bits, see alignment E=4.7e-89

Best Hits

Swiss-Prot: 100% identical to Y4396_MAGSA: Nucleotide-binding protein amb4396 (amb4396) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 100% identity to mag:amb4396)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYX5 at UniProt or InterPro

Protein Sequence (306 amino acids)

>AMB_RS22235 RNase adaptor protein RapZ (Magnetospirillum magneticum AMB-1)
MSDLHSSPTDQTSAPAHAGGGNRVVIVTGMSGAGKTMALKALEDMGWEAVDNLPLALAAS
LVRSGGGMARPLALGVDIRTRDFGVEPVLAALDHLMGESGLDVRLLFLDCEDDVLCRRFT
ETRRRHPMAVDRPLLDGIRHERALVSPLKRRADVMIDTTNQPPGEFKRLLAGHFGLESNG
GLGVFVTSFAYRNGLPREADLVFDARFLANPHYVPELKPLTGRDPAVAQYVAADPAFGPF
IESLTRLLEPLLPRFAAEGKSYLTIAVGCTGGRHRSVAIAEHLAQWMQRRGGKVELRHRE
LDERGS