Protein Info for AMB_RS22230 in Magnetospirillum magneticum AMB-1

Annotation: PTS fructose transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03610: EIIA-man
  • amino acids 3 to 115 (113 residues), 105.5 bits, E=9.3e-35

Best Hits

KEGG orthology group: K02793, PTS system, mannose-specific IIA component [EC: 2.7.1.69] (inferred from 100% identity to mag:amb4395)

Predicted SEED Role

"PTS system, mannose-specific IIA component"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

See Q2VYX6 at UniProt or InterPro

Protein Sequence (135 amino acids)

>AMB_RS22230 PTS fructose transporter subunit IIA (Magnetospirillum magneticum AMB-1)
MIGLVLVTHGRLADELVAALEHVVGPQPNVGAVCIGPDDDMEQRRNDILSSVARCDDGAG
VVVLTDMFGGTPSNLAISIMDKAKVEVIAGVNLPMLIKLASVRHSEALADAVASAQEAGR
KYINVASKLLTQDRK