Protein Info for AMB_RS22210 in Magnetospirillum magneticum AMB-1

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF05221: AdoHcyase" amino acids 3 to 462 (460 residues), 488.9 bits, see alignment E=7.8e-151 TIGR00936: adenosylhomocysteinase" amino acids 4 to 455 (452 residues), 600.1 bits, see alignment E=1e-184 PF00670: AdoHcyase_NAD" amino acids 224 to 383 (160 residues), 270.7 bits, see alignment E=7.6e-85 PF02826: 2-Hacid_dh_C" amino acids 242 to 333 (92 residues), 27.5 bits, see alignment E=2.9e-10

Best Hits

Swiss-Prot: 75% identical to SAHH_BRADU: Adenosylhomocysteinase (ahcY) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 100% identity to mag:amb4391)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYY0 at UniProt or InterPro

Protein Sequence (463 amino acids)

>AMB_RS22210 adenosylhomocysteinase (Magnetospirillum magneticum AMB-1)
MTDYVVADIALAAWGRKELDIAESEMPGLMATREEFGPSQPLKGARIAGSLHMTIQTGVL
IETLKALGADIRWASCNIFSTQDHAAAAIAAAGIPVFAVKGENLEEYWDYTHRIFEWADG
GCPNMILDDGGDATLLIHLGMRAEKDLSVLNNPTCEEEEVLFASIKKKLATDKTFYTRNG
TAIRGVTEETTTGVHRLYEMEKKGTLLWPAINVNDSVTKSKFDNKYGCRESLVDGIRRAT
DVMLAGKVAVVAGFGDVGKGSAESLASQGCRVIVTEIDPICALQACMEGYEVATMEEAAP
RGDIFVTTTGNVDVITVDHMRAMKDRAIVCNIGHFDSEIQVAGLKNFEWNNIKPQVDEIK
FPSGNRILLLAEGRLVNLGCATGHPSFVMSASFTNQVMAQIEIFTNPGKYEKKVYVLPKT
LDEKVAMLHLAKLGATLTKLNKKQSDYIGVAVEGPFKPETYRY