Protein Info for AMB_RS22200 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF00496: SBP_bac_5" amino acids 100 to 506 (407 residues), 236.4 bits, see alignment E=2.9e-74

Best Hits

Swiss-Prot: 49% identical to Y4WM_SINFN: Uncharacterized protein y4wM (NGR_a00920) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K13893, microcin C transport system substrate-binding protein (inferred from 100% identity to mag:amb4389)

Predicted SEED Role

"ABC transporter, periplasmic substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYY2 at UniProt or InterPro

Protein Sequence (592 amino acids)

>AMB_RS22200 ABC transporter substrate-binding protein (Magnetospirillum magneticum AMB-1)
MRALILALCLLLAPAVAAETVHPVHGLAMHGAPKYGPGFKHFDYVNPEAPKGGEIRLAEI
GGWDSLNPFIVKGDPPAGADLPFETLMVNSADEAFSEYGLIAESVEVPADRSWVIFNLRP
KARWHDGKPITADDVVFSFEVLKAKGHPRYRFYYAAVDKVEKLAERRVRFAFKPGDNREL
PLIVGQLPILPRHYWQGRDFAVTTLEPPLGSGPYKVAGFDTQHTITYERVKDYWGADLAV
RKGEYNFDRIRYDSYRDTTVALEAFKAGEYDWRSENEAKKWATAYEDWTGLKDGRGRKNA
FANQRPAGMQGYAFNLRRALFADIRVRRALGLAFDFEWTNKTLFYSQYKRTASYFANSEL
ASLGLPSPLELKVLEPLRGQIPPEVFTAEFKPPATEGDGNIRPNLRAAMRLLEEAGWRVV
DGKLVDGAGRPFAFEILLVQPAWERITLPFVRNLSRLGIEASVRTVDPAQYKNRIDHFDF
DMVVHVWGQSQSPGNEQLGYWGSESADEAGGQNVAGIKNKAVDALIEQVISAPDRETLVA
RTRALDRVLLWNHYVIPQWHLGLDRLVWWDKFGMPDTVPASGVQVMTWWVKK