Protein Info for AMB_RS22145 in Magnetospirillum magneticum AMB-1

Annotation: dienelactone hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01738: DLH
  • amino acids 64 to 284 (221 residues), 198.7 bits, E=4.7e-63

Best Hits

Swiss-Prot: 62% identical to DLHH_METEA: Putative carboxymethylenebutenolidase (MexAM1_META1p1735) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 100% identity to mag:amb4377)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

• 4-chlorocatechol degradation (2/5 steps found)
• 4,5-dichlorocatechol degradation (3/7 steps found)
• 3,4,6-trichlorocatechol degradation (4/9 steps found)
• 3-chlorocatechol degradation I (ortho) (1/5 steps found)
• 3-chlorocatechol degradation II (ortho) (1/5 steps found)
• 3,5-dichlorocatechol degradation (3/8 steps found)
• 1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Fluorobenzoate degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

See Q2VYZ4 at UniProt or InterPro

Protein Sequence (288 amino acids)

>AMB_RS22145 dienelactone hydrolase family protein (Magnetospirillum magneticum AMB-1)
MDDDVKSLSPKIDMTRRGFVSAAVLATGYALAVSPASAGAITTDSQGLSAGAVMIPTPGG
HPLPAYAAMPAGKGPFPIILVIQEIFGVHEHIRDVCRRFAKLGYLAVAPELYFRQGDPAV
LTDIPTILSTIVAKVPDSQVLSDLDAAAAWAAANGGDGDRLGVTGFCWGGRAVWLYSAHN
PKLKAAVAWYGKLVGAPSAETPKHPVDIAADLHAPVLGLYGGADQGIPLDSIEKMKAATK
PARVKVEFVVYPDTPHAFHADYRPSYREGPAKDGWAKALAWFKTNGVG