Protein Info for AMB_RS22115 in Magnetospirillum magneticum AMB-1

Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00018: pantoate--beta-alanine ligase" amino acids 5 to 282 (278 residues), 292.3 bits, see alignment E=2.8e-91 PF02569: Pantoate_ligase" amino acids 7 to 280 (274 residues), 334.8 bits, see alignment E=1.6e-104 TIGR00125: cytidyltransferase-like domain" amino acids 28 to 84 (57 residues), 32.5 bits, see alignment E=7.9e-12

Best Hits

Swiss-Prot: 100% identical to PANC_MAGSA: Pantothenate synthetase (panC) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 100% identity to mag:amb4371)

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ00 at UniProt or InterPro

Protein Sequence (284 amino acids)

>AMB_RS22115 pantoate--beta-alanine ligase (Magnetospirillum magneticum AMB-1)
MSTAVHIVRSVAALRAQVGAWRDEGLSVALVPTMGALHAGHLSLVKRGLELADRAVASVF
VNPTQFGPNEDFARYPRQEELDAAALSSAGCHLLFAPDVAEMYPEGFATTVSVSGVSDGL
CGAVRPGHFAGVATVVTKLLLQCLPDVALFGEKDYQQLAVIRRFARDLDIPVRIEGVPTL
REDDGLAMSSRNAYMTPEQRAIAPWLIRALTGIADGLRAGAKAADLCPMAVSGLLKAGFD
SVDYIEVRDAASLAPAEILDRPLRILAAARLGKTRLIDNIGVEP