Protein Info for AMB_RS22110 in Magnetospirillum magneticum AMB-1

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 7 to 269 (263 residues), 306.4 bits, see alignment E=9.4e-96 PF02548: Pantoate_transf" amino acids 9 to 264 (256 residues), 355 bits, see alignment E=1.3e-110

Best Hits

Swiss-Prot: 100% identical to PANB_MAGSA: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 100% identity to mag:amb4370)

MetaCyc: 48% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Thermococcus kodakarensis)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ01 at UniProt or InterPro

Protein Sequence (274 amino acids)

>AMB_RS22110 3-methyl-2-oxobutanoate hydroxymethyltransferase (Magnetospirillum magneticum AMB-1)
MSTEVRIKRITTRDIRARKGAEPLVVLTAYTAPIARLLDPICDILLVGDSLGMVVYGMET
TLAVTLEMMINHGAAVVRSSSRACVVVDMPFGSYQESKEQAFRNCARVMAETGCAAVKLE
GGRELAETIRFLTDRGIPVMAHIGLKPQAVHAAGGFRAQGRIESEAEAIRADARAITEAG
AFSVVVEGTVEPVAQALSAEIAIPTIGIGASAACDGQVLVIDDLVGLFDDFTPKFVKRYA
DLRPIITKAAEDYAAEVKARTFPGPEHCFGVAKK