Protein Info for AMB_RS22070 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome-c oxidase, cbb3-type subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 164 to 189 (26 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 385 to 411 (27 residues), see Phobius details amino acids 441 to 462 (22 residues), see Phobius details TIGR00780: cytochrome c oxidase, cbb3-type, subunit I" amino acids 10 to 477 (468 residues), 727.4 bits, see alignment E=4.1e-223 PF00115: COX1" amino acids 14 to 450 (437 residues), 406.8 bits, see alignment E=6e-126

Best Hits

Swiss-Prot: 70% identical to FIXN_RHIME: Cytochrome c oxidase subunit 1 homolog, bacteroid (fixN) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00404, cb-type cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 79% identity to rru:Rru_A3332)

MetaCyc: 68% identical to cytochrome cbb3 oxidase subunit I (Rhodobacter capsulatus)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>AMB_RS22070 cytochrome-c oxidase, cbb3-type subunit I (Magnetospirillum magneticum AMB-1)
MSINTEATPYRDDVIKKFTIAAIFWGVVGFLAGDFIALQLAFPVLNLDLEWTSFGRLRPV
HTSAVIFAFGGNVLFSTSLYIVQRTCRASLFGGSGLGGFIFWNFQALIVVAALSYVLGFS
QGQEYAEPEWWIDLWLTVIWVAYLIAFAGTIMKRKEPHIYVANWFFFAMILTIAMLHLGN
NIAVPAALFGGSWMKSYNVFGGVQNAMTQWWYGHNAVGFFLTAGFLGIMYYFVPKRAERP
VYSYRLSIVHFWALIFLYIWAGPHHLHYTALPDWAQTLGMTFSVMLWMPSWGGMINGLMT
LSGAWDKLRTDPVMRFLVSSVAFYGMSTFEGPMMSIKAVNSLSHYTDWGIGHVHSGALGW
VAFVSFGALYYLVPKLWGRKELYSLKLVGVHFWVATVGIVFYITAMWISGIMQGLMWRAY
DSLGFLQYSFIETVEAMRPYYMIRALGGFLFVLGSLVMVYNVFKTIKGDVAADEAVASTA
GAAR