Protein Info for AMB_RS22065 in Magnetospirillum magneticum AMB-1

Annotation: class I SAM-dependent rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF17785: PUA_3" amino acids 15 to 80 (66 residues), 70.8 bits, see alignment E=1.7e-23 PF02475: Met_10" amino acids 130 to 278 (149 residues), 27.4 bits, see alignment E=7e-10 PF10672: Methyltrans_SAM" amino acids 181 to 344 (164 residues), 82.6 bits, see alignment E=7.2e-27 PF03602: Cons_hypoth95" amino acids 227 to 307 (81 residues), 26.3 bits, see alignment E=1.4e-09 PF13847: Methyltransf_31" amino acids 228 to 348 (121 residues), 31.1 bits, see alignment E=4.6e-11

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 62% identity to rru:Rru_A3333)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>AMB_RS22065 class I SAM-dependent rRNA methyltransferase (Magnetospirillum magneticum AMB-1)
MTQTHPDQPAARPVIRLAKGRSKRLRAGHPWVFSNEIEMGAEAKALPPGSLVTLMDAGDE
RLGVATFNPHSLIAARVLSRRAADTVDVDFLAERLRAALALRDTLFPTPHYRLVHSEADR
LPGLIVDRYGDVLAVQTNTAGMERLLPVLLDALQMVLAPRAVVLVNDSPVRKLEGLEPHH
DVAFGQVDGPVELEENGCRFVADLTGGQKTGWFFDQRDNRAFVARLAKGRRVLDLYTYAG
GFAVQAAKAGATQTIAVDRSEHSLALADQAARLNGVEVQTVRAEAFAEMERLALAGERFG
LVVADPPAFVKSRKDLGAGAKGYRKMARLAAALVEPGGFLLCASCSHHMPVETFAEEIGH
GLHLAGRSGRILRSAGAASDHPVHPWLPESAYLKAQVFQLD