Protein Info for AMB_RS22015 in Magnetospirillum magneticum AMB-1

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF13489: Methyltransf_23" amino acids 11 to 138 (128 residues), 42.5 bits, see alignment E=1.5e-14 PF13847: Methyltransf_31" amino acids 31 to 146 (116 residues), 40.5 bits, see alignment E=6e-14 PF13649: Methyltransf_25" amino acids 34 to 124 (91 residues), 58.6 bits, see alignment E=2e-19 PF08241: Methyltransf_11" amino acids 35 to 127 (93 residues), 52.5 bits, see alignment E=1.6e-17 PF08242: Methyltransf_12" amino acids 35 to 126 (92 residues), 40.3 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 46% identical to TAM_AZOSB: Trans-aconitate 2-methyltransferase (tam) from Azoarcus sp. (strain BH72)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 100% identity to mag:amb4352)

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ19 at UniProt or InterPro

Protein Sequence (256 amino acids)

>AMB_RS22015 methyltransferase domain-containing protein (Magnetospirillum magneticum AMB-1)
MAWDPAIYSAFAQPRLRPALDLMARIDLADARRVVDLGCGTGNVTRILKERWADADVIGI
DSSPEMLMTARDHGGAVRYLEGDAAGWAENGGEVDILFSNAALHWLDGHDSLFPKLMERV
SSGGVLAVQMPHNHYAASHTIMAEAASAGPWAEVLGPLAARFPVGEPSFYYDLLAAHSSH
IDIWETEYLHVLEGDNPVVTWTKGTALRPLMTAVDGAWATGFLAEYARRIQAAYPPRPDG
KTLFPFRRLFMVARKD