Protein Info for AMB_RS21980 in Magnetospirillum magneticum AMB-1

Annotation: prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details PF01040: UbiA" amino acids 36 to 276 (241 residues), 95.2 bits, see alignment E=2e-31

Best Hits

KEGG orthology group: K02548, 1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC: 2.5.1.- 2.5.1.74] (inferred from 100% identity to mag:amb4345)

Predicted SEED Role

"1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)" (EC 2.5.1.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ26 at UniProt or InterPro

Protein Sequence (315 amino acids)

>AMB_RS21980 prenyltransferase (Magnetospirillum magneticum AMB-1)
MTHVNADNPRPSQSGPMPGLPRTLFLATRPMFLPAALIPVLVGSAWGIHRAHAADPLALA
LAAAAMACLHAGANVINDVGDELNGADRLNQDRIPPFTGGSRFIQEGRLGLRAMALWGVA
LLLAAAGLGGILSLAKGEWVLAFGLVGGALALAYSLPPFSLASRGLGEAAVALGFGLPVA
ACFWLQSGSVGLEAILCSAIVGAWTAAILIVNEVPDLAADAQAGKRTLVVRLGAKGAPSL
YLSVQAVASALMLALGWLSQLPPWAVVPPLLTMLAALAATPLMAGGRAGQLAAIRITLGI
HLLGGLCLAGAAFLG