Protein Info for AMB_RS21915 in Magnetospirillum magneticum AMB-1

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details PF00892: EamA" amino acids 18 to 148 (131 residues), 49.1 bits, see alignment E=3.3e-17 amino acids 161 to 288 (128 residues), 46.9 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb4332)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VZ39 at UniProt or InterPro

Protein Sequence (297 amino acids)

>AMB_RS21915 EamA/RhaT family transporter (Magnetospirillum magneticum AMB-1)
MSSDFHSPGSLRPHHAGGIAAMLAATSLFAGMDALAKLLMAADYSVVQVLFFRAAFGLLP
LVPLVWRGGLRSVATQRPWTHVIRSTIALVAVGCFFQAIHRLPLAQVTAIGFAAPLLITA
LSVPLLKEHVSLGRWLAVAAGFGGILLVAGPEAWAGDLLGLGAALAVAGTFLYALVIVLM
RVMGRTEAAVTTVFWFSVLTMILCGAALPLVWRTPDTQAWGLFAATGILGGIAQLLISQA
VRLAPASLVAPFDYFHIVVSASLGWLLFSEIPTLNTLAGALVVMASGLYVLRSDKGR